Rapidmail.de - SEO Checker

Overview of the SEO Check
Meta information
100% 
Page quality
91% 
Page structure
79% 
Link structure
73% 
Server
100% 
External factors
100% 
SEO Score
Response time
0.09 s
File size
390.60 kB
Words
1438
Media files
71
Number of links
115 internal / 10 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Die einfach gute Newsletter-Software: rapidmail
The length of the page title is perfect. (425 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
Das DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!
The length of the meta description is perfect. (907 pixels out of 1000 max pixel length)
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.rapidmail.de/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de
Server location: Germany
The following language is defined by HTML: de
Alternate/Hreflang Links
(Somewhat important)
The specified alternate links have no errors.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
apple-mobile-web-app-titlerapidmail - DE
viewportwidth=device-width, initial-scale=1.0, maximum-scale=2.0
robotsindex, follow
descriptionDas DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!
theme-color#e9edf2
google-site-verificationn7Q1LVmSVbxGU5QhFL2eAwx5O0V1zCJ6PL7yRXc9H_U
langde
og:localede_DE
og:site_namerapidmail.de
og:typewebsite
og:urlhttps://www.rapidmail.de/
og:imagehttps://www.rapidmail.de/images/assets/rapidmail_256x256.png
og:titleDie einfach gute Newsletter-Software: rapidmail
og:descriptionDas DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!
charsetutf-8

Automatically check rapidmail.de including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Page quality

Content
(Critically important)
This page contains 1438 words. That's ok.
39.6% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
Words from the H1 heading are used in the page content.
The page contains a listing, which indicates a good text layout.
26 paragraphs were found on this page.
The text content is perfect.
No placeholders texts or images were found.
There are no duplicates on the site.
The average number of words per sentence of 11.67 words is good.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
A viewport "width=device-width, initial-scale=1.0, maximum-scale=2.0" is provided.
At least one Apple touch icon is specified.
Bold and strong tags
(Somewhat important)
The following tag is repeated too often: 4,7
Image SEO
(Somewhat important)
37 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
This page is optimized perfectly for social networks.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/images/main/logo-positive.svg?v=2rapidmail - POSITIVE
...a73362e899de2d90f27a0aeac967-320x426.pngNo alt attribute provided
...d278b4f69b4e9756529e3cdf501a-315x316.svgNo alt attribute provided
...cd53c513da29f3d37d2d094beee1-224x234.svgNo alt attribute provided
...90585bcc5a2350c28fcdd0fc78c9-320x453.pngNo alt attribute provided
...c46b176c1b5c5a7db5b967a87409-341x336.svgNo alt attribute provided
...1c69a835129f655a88a1dbca26f0-397x266.svgNo alt attribute provided
/images/main/features/mailing-editor.pngEinblick in die rapidmail Newsletter-Software
/images/main/features/reports-devices.pngNo alt attribute provided
/images/main/features/reports-opens.pngNo alt attribute provided
/images/main/customer/companies.svgCHECK24 / Hanse Merkur / Volkswagen / Deutsche Umweltstiftung / Katjes
/images/main/trust/omr_lead_24q4.svgOMR Reviews - Leader - E-Mail Marketing
/images/main/trust/omr_tr_25q2.svgOMR Reviews - Top Rated - E-Mail Marketing
/images/main/trust/omr_reviews_25q3.pngOMR Reviews
/images/main/trust/trustpilot__logo.svgTrustpilot
...ges/main/trust/trustpilot__stars-4_5.svgTrustpilot Bewertung
/images/main/ui/bulb.svgNo alt attribute provided
...s/main/features/drag-and-drop-editor.pngrapidmail Drag-and-Drop Newsletter-Editor für eine intuitive Mailing-Gestaltung
/images/main/ui/arrow-4-accent.svgNo alt attribute provided
/images/main/features/automation-email.pngNo alt attribute provided
.../ui/templates/template-birthday--320.pngrapidmail Newsletter Vorlage
/images/main/ui/octopus.svgIntuitives E-Mail-Marketing-Automation-Tool
/images/main/ui/arrow-4-accent.svgNo alt attribute provided
...eatures/empfaengeraktivitaet-tracken.pngrapidmail Newsletter-Statistik zum einfachen Messen des Mailing-Erfolgs
/images/main/ui/arrow-4-accent.svgNo alt attribute provided
...konforme-verwaltung-empfaengerlisten.pngÜbersicht der in rapidmail angelegten Newsletter-Empfängerlisten
/images/main/ui/armadillo-dsgvo.svgNo alt attribute provided
/images/main/ui/arrow-4-accent.svgNo alt attribute provided
/images/main/features/1klick-url.svg1-Klick-Design URL eingeben
...ges/main/features/formular-anmeldung.pngNo alt attribute provided
...eatures/formular-anmeldung-gebrandet.pngAnsprechendes Newsletter-Anmeldeformular im eigenen Unternehmensdesign
/images/main/ui/arrow-4-accent.svgNo alt attribute provided
/images/main/ui/flamingo.svgNo alt attribute provided
...s/main/ui/templates/template-10--320.pngrapidmail Newsletter-Vorlage für Unternehmen
...main/features/1klick-template-before.pngrapidmail Newsletter-Vorlage für Online-Shops
.../main/features/1klick-template-after.pngrapidmail Newsletter-Vorlage für Online-Shops
/images/main/ui/1-klick-visual.pngNo alt attribute provided
...s/main/ui/templates/template-02--320.pngrapidmail Newsletter-Vorlage für Weihnachten
...s/main/ui/templates/template-15--320.pngrapidmail Newsletter-Vorlage für Unternehmen
...s/main/ui/templates/template-11--320.pngrapidmail Newsletter-Vorlage für Online-Shops
...s/main/ui/templates/template-16--320.pngrapidmail Newsletter-Vorlage für Ostern
...s/main/ui/templates/template-14--320.pngrapidmail Newsletter-Vorlage für Gastronomie
...s/main/ui/templates/template-13--320.pngrapidmail Newsletter-Vorlage für Online-Shops
...s/main/ui/templates/template-03--320.pngrapidmail Newsletter-Vorlage für Automobil
/images/main/ui/awards-customer.pngNo alt attribute provided
/images/main/ui/trophy.svgNo alt attribute provided
/images/main/trust/omr_lead_24q4.svgOMR Reviews - Leader - E-Mail Marketing
/images/main/trust/omr_reviews_25q3.pngOMR Reviews
/images/main/trust/omr_tr_25q2.svgOMR Reviews - Top Rated - E-Mail Marketing
/images/main/trust/trustpilot__logo.svgTrustpilot
...ges/main/trust/trustpilot__stars-4_5.svgTrustpilot Bewertung
/images/main/trust/omr-stars-5.svg5 Sterne: hervorragend
/images/main/customer/companies-dark.svgCHECK24 / Hanse Merkur / Volkswagen / Deutsche Umweltstiftung / Katjes
/images/main/ui/support-headset.svgNo alt attribute provided
/images/main/team/fabian--192x120.jpgNo alt attribute provided
/images/main/team/markus--192x120.jpgNo alt attribute provided
/images/main/team/frank--192x120.jpgNo alt attribute provided
/images/main/team/lea--192x120.jpgNo alt attribute provided
/images/main/team/tom--192x120.jpgNo alt attribute provided
/images/main/ui/bee-yellow-glasses-2.svgNo alt attribute provided
/images/main/ui/speech-bubble-white.svgNo alt attribute provided
.../sites/3/2019/12/guide-start-768x384.jpgNo alt attribute provided
...nes-Email-Template-erstellen-768x384.jpgNo alt attribute provided
...letter-im-Unternehmensdesign-768x384.pngNo alt attribute provided
/images/main/ui/book-bulb.svgNo alt attribute provided
/images/main/trust/seals.svgDSGVO-konform / Serverstandort Deutschland / Externer Datenschutzbeauftragter
...fefbd01814468a433826653e93e8c-146x50.svgNo alt attribute provided
...5b1ae0ffe9f97eaf68590c40979e88-48x48.svgNo alt attribute provided
...5b09a07f15762c70a59ba6e82a7215-48x48.svgNo alt attribute provided
...a0ba032be3c44c0add60e3729da47e-48x48.svgNo alt attribute provided
Video URLWidthHeight
...2/2025/03/rapidmail-Produktvideo-v4.webm813457

Page structure

H1 heading
(Critically important)
Einfach gute Newsletter-Software
The H1 heading is perfect.
Headings
(Important)
There are 35 headings on the page. The amount of headings should be in a more proper relation to the amount of text.

Heading structure

Heading levelContent
H1 Einfach gute Newsletter-Software
H2 Professionelles E-Mail-Marketing kann jeder – mit rapidmail.
H2 Wie funktioniert erfolgreiches E-Mail-Marketing?
H2 Über 250 kostenlose Newsletter-Vorlagen
H2 Ausgezeichnet
H2 Kostenloser Support Für alle Kunden, für immer!
H2 Das Newsletter-Tool für alle
H2 Unsere Newsletter-Tipps & -Tricks
H2 FAQs zum rapidmail Newsletter-Tool
H3 Geliebt von über 250.000 Unternehmen
H3 Bestbewertet
H3 Newsletter gestalten wie ein Profi
H3 Workflows einfach automatisieren
H3 Zielgruppen verstehen und Newsletter optimieren
H3 Newsletter-Kontakte einfach verwalten
H3 Einfach Newsletter-Anmeldungen gewinnen
H3 E-Commerce
H3 Unternehmen
H3 Agenturen
H3 Vereine
H3 Selbstständige
H3 Den ersten Newsletter erstellen und versenden: So gelingt’s
H3 Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
H3 Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
H3 Was ist rapidmail?
H3 Welche Funktionen bietet rapidmail?
H3 Über welche Schnittstellen verfügt rapidmail?
H3 Was unterscheidet rapidmail von anderen Newsletter-Tools?
H3 Wie benutzerfreundlich ist rapidmail?
H3 Wie sicher sind meine Daten bei rapidmail?
H3 Welche Tarife gibt es bei rapidmail?
H3 Kann man rapidmail kostenlos testen?
H3 Welchen Kundenservice bietet rapidmail?
H3 Welches Newsletter-Tool passt zu mir?
H4 Der rapidmail-Newsletter
Some internal link anchor texts are too long.
Some anchor texts are used more than once.
The number of internal links is ok.
All internal links are not using dynamic parameters.
There are 10 external links on this page.
LinkAttributesAnchor text
https://www.rapidmail.de/IMG-ALT rapidmail - POSITIVE
A-TITLE rapidmail - Newsletter Software
/funktionen-newsletter-erstellenNewsletter gestalten Gestalten Sie einfach und schnell schöne Newsletter.
A-TITLE Newsletter gestalten
/funktionen-newsletter-versendenNewsletter versenden Versenden Sie E-Mails ganz einfach flexibel und zuverlässig.
A-TITLE Newsletter versenden
/funktionen-newsletter-reportingNewsletter auswerten Verstehen Sie besser, welche Inhalte gut ankommen.
A-TITLE Newsletter auswerten
/funktionen-kontakte-verwaltenKontakte verwalten Behalten Sie stets den Überblick über Ihre Newsletter-Kontakte.
A-TITLE Kontakte verwalten
/funktionen-kontakte-gewinnenKontakte gewinnen Finden Sie DSGVO-konform neue Abonnent:innen für Ihre Newsletter.
A-TITLE Kontakte gewinnen
/funktionen-email-automation-toolE-Mail-Automation Sparen Sie Zeit mit automatisierten E-Mail-Workflows.
A-TITLE E-Mail-Automation
/funktionen-transaktionsmails-...Transaktionsmails versenden Versenden Sie zuverlässig SMTP-Mails an Ihre Kontakte.
A-TITLE Transaktionsmails versenden
/funktionen-plugins-integrationenShop-Integrationen Verbinden Sie Ihr Shopsystem einfach mit rapidmail.
A-TITLE Shop-Integrationen
/newsletter-funktionenAlle Funktionen
/kostenlose-newsletter-vorlagenNewsletter-Vorlagen Über 250 kostenlose Vorlagen und Design-Templates. Einfach anpassen und los. Alle Newsletter-Vorlagen
/preise-newsletterversandPreise
A-TITLE Preise
/warum-rapidmail-referenzenrapidmail ist ausgezeichnet! Diese Erfahrungen machen über 200.000 Kund:innen mit unserer bestbewerteten Software. Warum rapidmail?
https://www.rapidmail.de/supportKostenloser Support Unsere Support-Enthusiast:innen helfen Ihnen bei allen Fragen.
A-TITLE Kostenloser Support
/dsgvo-konformes-email-marketingMaximaler Datenschutz Unsere Newsletter-Software ist zu 100 % DSGVO-konform.
A-TITLE Maximaler Datenschutz
/maximale-zustellbarkeit-fuer-...Exzellente Zustellbarkeit Wir bringen Ihre Newsletter immer zuverlässig ins Ziel.
A-TITLE Exzellente Zustellbarkeit
/ueber-rapidmailÜber rapidmail Lernen Sie die Gesichter hinter den rapidmail-Kulissen kennen.
A-TITLE Über rapidmail
/smarte-software-fuer-ecommerc...E-Commerce Steigern Sie Ihren Shop-Umsatz durch gezielte Produkt-Newsletter.
A-TITLE E-Commerce
/effektives-newsletter-marketi...Unternehmen Erweitern Sie Ihren Kundenstamm durch personalisierte Mailings.
A-TITLE Unternehmen
/smartes-newsletter-tool-fuer-...Agenturen Setzen Sie Kampagnen für Kund:innen einfach und professionell um.
A-TITLE Agenturen
/email-marketing-software-fuer...Fitnessstudios Begeistern Sie Ihre Community mit Ihren Fitnessangeboten.
A-TITLE Fitnessstudios
/schnell-und-einfach-newslette...Vereine Halten Sie Mitglieder und Sponsor:innen kostengünstig auf dem Laufenden.
A-TITLE Vereine
/effizientes-email-marketing-f...Selbstständige Gewinnen Sie nachhaltig neue Kund:innen für Ihr Unternehmen.
A-TITLE Selbstständige
/email-marketing-software-fuer...Hotels Sorgen Sie mit attraktiven Angeboten für ausgebuchte Zimmer.
A-TITLE Hotels
https://www.rapidmail.de/blograpidmail Blog Hilfreiche Tipps, kreative Ideen und die neuesten Trends: Alles, was Sie für erfolgreiche Newsletter brauchen. Zum Blog
/newsletter-guidesNewsletter-Guides Leicht verständliche Schritt-für-Schritt-Anleitungen.
A-TITLE Newsletter-Guides
/ebooks-und-downloadsKostenlose Downloads E-Books, Checklisten, Textvorlagen und mehr gratis herunterladen.
A-TITLE Kostenlose Downloads
https://us02web.zoom.us/webina...External Subdomain Webinare Live erklärt: Lernen Sie Schritt für Schritt, wie Sie rapidmail optimal nutzen.
A-TITLE Webinare
/ebooks-und-downloads/e-mail-m...E-Mail-Marketing für Anfänger Sie wollen mit E-Mail-Marketing beginnen, aber wissen nicht wie? Unser gratis E-Book mit allen E-Mail-Marketing Basics hilft Ih...
https://www.rapidmail.de/hilfeHilfecenter Anleitungen und Hilfestellungen zur optimalen Nutzung unseres Newsletter-Tools: Hier finden Sie Antworten auf alle Ihre Fragen rund um rapidmail....
/hilfe/kategorie/mailing-erste...Mailing erstellen & versenden Gelungene Formatierung Ihrer Mailings, Nutzung des Editors, Versand planen, ...
A-TITLE Mailing erstellen & versenden
/hilfe/kategorie/empfangerverw...Empfängerverwaltung Empfängerlisten anlegen, Kontakte importieren, Segmentierung Ihrer Kontakte, ...
A-TITLE Empfängerverwaltung
/hilfe/kategorie/zustellbarkeitZustellbarkeit DKIM, SPF und DMARC, Spam-Einstufung vermeiden, verbesserte Zustellbarkeit, ...
A-TITLE Zustellbarkeit
https://www.rapidmail.de/videosVideo-Tutorials Dank der einfachen Video-Anleitungen wird E-Mail-Marketing ein Kinderspiel für Sie — einfach einschalten, zurücklehnen, zuhören und umsetzen!...
https://www.rapidmail.de/kontaktKontakt
A-TITLE Kontakt
https://www.rapidmail.de/loginLogin
https://app.storylane.io/share...External Subdomain Blick ins Tool
https://www.rapidmail.de/registerKostenlos starten
https://www.rapidmail.de/registerJetzt kostenlos starten
https://www.rapidmail.de/Anchor Mehr Informationen
https://www.rapidmail.de/Anchor 4,7 (2.140)
IMG-ALT OMR Reviews - Leader - E-Mail Marketing
A-TITLE Mehr Informationen
/funktionen-newsletter-erstellenText duplicate Mehr Informationen
/funktionen-email-automation-toolText duplicate Mehr Informationen
/funktionen-newsletter-reportingText duplicate Mehr Informationen
/funktionen-kontakte-verwaltenText duplicate Mehr Informationen
/funktionen-kontakte-gewinnenText duplicate Mehr Informationen
/kostenlose-newsletter-vorlagenVorlagen entdecken
A-TITLE Kostenlose Newsletter-Vorlagen
https://omr.com/de/reviews/pro...New window External Anchor IMG-ALT OMR Reviews
A-TITLE OMR Reviews
https://de.trustpilot.com/revi...New window External Subdomain Text duplicate 4,7 (2.140)
IMG-ALT Trustpilot
A-TITLE Trustpilot
/warum-rapidmail-referenzenErfahrungen mit rapidmail
https://www.rapidmail.de/supportText duplicate Mehr Informationen
A-TITLE Kostenloser Support
https://www.rapidmail.de/kontaktJetzt kontaktieren
A-TITLE Kontakt
/smarte-software-fuer-ecommerc...E-Commerce
/effektives-newsletter-marketi...Unternehmen
/smartes-newsletter-tool-fuer-...Agenturen
/schnell-und-einfach-newslette...Vereine
/effizientes-email-marketing-f...Selbstständige
/newsletter-guides/den-ersten-...A-TITLE Den ersten Newsletter erstellen und versenden: So gelingt’s
/newsletter-guides/den-ersten-...Text duplicate Den ersten Newsletter erstellen und versenden: So gelingt’s
A-TITLE Den ersten Newsletter erstellen und versenden: So gelingt’s
/newsletter-guides/email-templ...A-TITLE Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
/newsletter-guides/email-templ...Text duplicate Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
A-TITLE Eigenes E-Mail-Template erstellen im Corporate Design: So geht’s!
/blog/1-klick-design-fuer-auto...A-TITLE Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
/blog/1-klick-design-fuer-auto...Text duplicate Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
A-TITLE Jetzt neu: Mit dem 1-Klick-Design automatisch Newsletter im Firmendesign erstellen
https://www.rapidmail.de/blogMehr aus dem Blog
/newsletter-guidesNewsletter-Guides
/ebooks-und-downloadsE-Books
https://www.rapidmail.de/videosVideo-Tutorials
https://www.rapidmail.de/kontaktKontaktieren Sie uns gerne!
A-TITLE Kontakt
/funktionen-newsletter-erstellenNewsletter online gestalten
/funktionen-newsletter-reportingNewsletter-Reporting
/funktionen-kontakte-verwaltenNewsletter-Kontakte übersichtlich organisiert
/funktionen-kontakte-gewinnenneue Newsletter-Anmeldungen gewonnen werden. Über die
/funktionen-plugins-integrationenNewsletter-Plugins
/funktionen-transaktionsmails-...Versand von Transaktionsmails
/funktionen-plugins-integrationenText duplicate Newsletter-Plugins
/dsgvo-konformes-email-marketingNewsletter-Marketing automatisch DSGVO-konform
/preise-newsletterversandNewsletterversand zu fairen Preisen
/preise-newsletterversandProbieren Sie es direkt aus!
https://www.rapidmail.de/kontaktkostenlosen Support
A-TITLE Kontakt
/newsletter-tool-vergleichNewsletter-Tool-Vergleich
https://www.rapidmail.de/kontaktText duplicate Jetzt kontaktieren
A-TITLE Kontakt
https://www.rapidmail.de/A-TITLE Startseite
/newsletter-funktionenFunktionen
/preise-newsletterversandText duplicate Preise
/kostenlose-newsletter-vorlagenNewsletter-Vorlagen
/shopware-6-newsletter-integra...Shopware 6 Plugin
https://www.rapidmail.de/supportKostenloser Support
/dsgvo-konformes-email-marketingDatenschutz & Sicherheit
/maximale-zustellbarkeit-fuer-...Zustellbarkeit & Whitelisting
/newsletter-tool-vergleichNewsletter-Tools
/mailchimp-rapidmail-vergleichrapidmail vs. Mailchimp
/sendinblue-rapidmail-vergleichrapidmail vs. Brevo (Sendinblue)
/smarte-software-fuer-ecommerc...Text duplicate E-Commerce
/effektives-newsletter-marketi...Text duplicate Unternehmen
/smartes-newsletter-tool-fuer-...Text duplicate Agenturen
/schnell-und-einfach-newslette...Text duplicate Vereine
/effizientes-email-marketing-f...Text duplicate Selbstständige
/email-marketing-software-fuer...Hotels
/service-partnerService Partner
/affiliate-partnerAffiliate Partner
/ueber-rapidmailÜber uns
/warum-rapidmail-referenzenKundenstimmen
https://www.rapidmail.de/blogBlog
https://www.rapidmail.de/jobsJobs Wir stellen ein!
https://www.rapidmail.de/kontaktText duplicate Kontakt
https://www.rapidmail.de/hilfeHilfecenter
https://www.rapidmail.de/videosText duplicate Video-Tutorials
https://us02web.zoom.us/webina...New window External Subdomain Anchor Webinare NEU
/newsletter-guidesText duplicate Newsletter-Guides
/newsletter-guides/den-ersten-...Newsletter erstellen
/newsletter-guides/e-mail-mark...E-Mail-Marketing
/newsletter-guides/mit-direktm...Direktmarketing
/ebooks-und-downloadsE-Books & Downloads
https://www.positive-group.com/New window External Subdomain No Text
/dsgvo-konformes-email-marketingText duplicate Datenschutz & Sicherheit
/maximale-zustellbarkeit-fuer-...Text duplicate Zustellbarkeit & Whitelisting
/ueber-rapidmailMade in Freiburg
/anti-spam-policyAnti-Spam-Policy
/datenschutzDatenschutz
https://www.rapidmail.de/agbAGB
/impressumImpressum
https://www.instagram.com/rapi...New window External Subdomain No Text
https://www.facebook.com/rapid...New window External Subdomain No Text
https://www.linkedin.com/compa...New window External Subdomain No Text
https://www.youtube.com/@rapid...New window External Subdomain No Text

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://www.rapidmail.de/"
HTTP header
(Important)
No X-Powered HTTP header is sent.
The web server transmits the web page (HTML) in compressed form.
Performance
(Somewhat important)
The page response time is excellent with 0.09 seconds.
The file size of the HTML document is fine (391 kB).

HTTP Response Header

NameValue
servernginx
dateWed, 02 Jul 2025 20:32:48 GMT
content-typetext/html; charset=UTF-8
varyAccept-Encoding
set-cookie69 Characters
expiresThu, 19 Nov 1981 08:52:00 GMT
cache-controlno-store, no-cache, must-revalidate
pragmano-cache
x-rm-ballb1
content-encodinggzip
statuscode200
http_versionHTTP/2

External factors

This website has excellent links from other websites.
This page has backlinks from 855 referring domains.
This page has 3,404 backlinks.
This page has backlinks from 660 different ip addresses.

Links from Wikipedia

No links from Wikipedia were found.

Search preview

www.rapidmail.de
Die einfach gute Newsletter-Software: rapidmail
Das DSGVO-konforme Newsletter-Tool aus Deutschland: Ganz einfach Newsletter ✓ gestalten ✓ versenden ✓ auswerten ► Jetzt kostenlos testen!

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
einfach84%Check
einfach Newsletter76%Check
Newsletter73%Check
Newsletter-Software63%Check
gut62%Check
rapidmail61%Check
Newsletter versenden59%Check
Newsletter gestalten59%Check
rapidmail Newsletter-Software59%Check
Newsletter im57%Check

Automatically check rapidmail.de including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions