Kanzlei-erven.de - SEO Checker

Overview of the SEO Check
Meta information
100% 
Page quality
98% 
Page structure
100% 
Link structure
96% 
Server
84% 
External factors
63% 
SEO Score
Response time
0.74 s
File size
204.30 kB
Words
1225
Media files
10
Number of links
54 internal / 22 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Ihr Fachanwalt für Verkehrsrecht in Köln | Kanzlei Erven
The length of the page title is perfect. (499 pixels out of 580 max pixel length)
There are no duplicate words in the title
Meta description
(Critically important)
▶️ TOP bewerteter Fachanwalt für Verkehrsrecht in Köln auf Google ✅ Hilfe bei Bußgeldverfahren, Fahrverbot, Unfallflucht u.v.m. ☎ 0221 301 403 44.
The length of the meta description is perfect. (937 pixels out of 1000 max pixel length)
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.kanzlei-erven.de/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: de
Language defined in HTML: de
Server location: Germany
The following language is defined by HTML: de
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1.0
description▶️ TOP bewerteter Fachanwalt für Verkehrsrecht in Köln auf Google ✅ Hilfe bei Bußgeldverfahren, Fahrverbot, Unfallflucht u.v.m. ☎ 0221 301 403 44.
robotsfollow, index, max-snippet:-1, max-video-preview:-1, max-image-preview:large
google-site-verificationjifOECzOGUMfIOohFPxIZA6XD2Gk44vh4spMWjM0HHY
generatorWP Rocket 3.19.3
msapplication-TileImagehttps://www.kanzlei-erven.de/wp-content/uploads/2018/11/cropped-fachanwalt-vekehrsrecht-favicon-270x270.png
article:published_time2014-10-07T16:59:35+02:00
article:modified_time2023-08-22T16:23:51+02:00
langde
twitter:cardsummary_large_image
twitter:titleIhr Fachanwalt für Verkehrsrecht in Köln | Kanzlei Erven
twitter:description▶️ TOP bewerteter Fachanwalt für Verkehrsrecht in Köln auf Google ✅ Hilfe bei Bußgeldverfahren, Fahrverbot, Unfallflucht u.v.m. ☎ 0221 301 403 44.
twitter:imagehttps://www.kanzlei-erven.de/wp-content/uploads/2014/10/cache_24530539.jpg
twitter:label1Verfasst von
twitter:data1t.erven
twitter:label2Lesedauer
twitter:data22 Minuten
og:localede_DE
og:typewebsite
og:titleIhr Fachanwalt für Verkehrsrecht in Köln | Kanzlei Erven
og:description▶️ TOP bewerteter Fachanwalt für Verkehrsrecht in Köln auf Google ✅ Hilfe bei Bußgeldverfahren, Fahrverbot, Unfallflucht u.v.m. ☎ 0221 301 403 44.
og:urlhttps://www.kanzlei-erven.de/
og:site_nameFachanwalt für Verkehrsrecht in Köln
og:updated_time2023-08-22T16:23:51+02:00
og:imagehttps://www.kanzlei-erven.de/wp-content/uploads/2014/10/cache_24530539.jpg
og:image:secure_urlhttps://www.kanzlei-erven.de/wp-content/uploads/2014/10/cache_24530539.jpg
og:image:width224
og:image:height361
og:image:altAnwalt Verkehrsrecht Köln
og:image:typeimage/jpeg
charsetUTF-8

Automatically check kanzlei-erven.de including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Page quality

Content
(Critically important)
This page contains 1225 words. That's ok.
42.4% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
Words from the H1 heading are used in the page content.
The page contains a listing, which indicates a good text layout.
32 paragraphs were found on this page.
The text content is perfect.
No placeholders texts or images were found.
There are no duplicates on the site.
The average number of words per sentence of 20.43 words is good.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
A viewport "width=device-width, initial-scale=1.0" is provided.
At least one Apple touch icon is specified.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 25 tags for this page.
Image SEO
(Somewhat important)
1 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
This page is optimized perfectly for social networks.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
...oads/2019/12/fachanwalt-vekehrsrecht.pngfachanwalt vekehrsrecht
...19/12/fachanwalt-verkehrsrecht-erven.pngfachanwalt-verkehrsrecht-erven
data:[...] Base64Google My Business Icon
data:[...] Base64Hier ein PDF kannst du herunterladen
data:[...] Base64arbeitsgemeinschaft-verkehrsanwaelte
data:[...] Base64Mitgliedschaft-Strafrecht
data:[...] Base64No alt attribute provided
data:[...] Base64juraforum-logo-fachanwalt
data:[...] Base64anwalt.org
data:[...] Base64Erfahrungen & Bewertungen zu Anwaltskanzlei Erven

Page structure

H1 heading
(Critically important)
Ihr Fachanwalt für Verkehrsrecht in Köln - Thomas Erven
The H1 heading is perfect.
Headings
(Important)
The heading structure is perfect.

Heading structure

Heading levelContent
H1 Ihr Fachanwalt für Verkehrsrecht in Köln - Thomas Erven
H2 Wir setzen Ihr Recht durch!
H2 Rechtsanwalt Verkehrsrecht Köln
H2 Unsere Tätigkeitsbereiche im Einzelnen:
H2 Aktuelle Bewertung auf google.de
H2 Anwalt bei Fahrerflucht und Unfallflucht, Körperverletzung, Alkoholfahrt / Drogenfahrt
H2 Terminvereinbarung unter: 0221 / 301 403 44
H2 Beliebte Beiträge
H3 Wie kann mir ein Anwalt für Verkehrsrecht helfen?
Some anchor texts are used more than once.
1 links don't have an anchor text.
The number of internal links is ok.
None of the anchor texts is too long.
All internal links are not using dynamic parameters.
There are 22 external links on this page.
LinkAttributesAnchor text
https://www.xing.com/profile/T...New window External Subdomain No Text
https://de.linkedin.com/in/tho...New window External Subdomain No Text
https://twitter.com/KanzleiErvenNew window External No Text
https://www.facebook.com/Kanzl...New window External Subdomain No Text
https://www.google.com/maps/pl...New window External Subdomain No Text
https://www.kanzlei-erven.de/IMG-ALT fachanwalt vekehrsrecht
https://www.kanzlei-erven.de/No Text
/ueber-uns/Über uns
/bewertungen/Bewertungen
/taetigkeitsbereiche/Tätigkeiten
/taetigkeitsbereiche/Übersicht
/aktuelles-und-kanzleiblog/Kanzleiblog
/wir-suchen-verstaerkung/Jobs
/kontakt/Kontakt
/impressum/Impressum
/datenschutzbestimmungen/Datenschutz
/anhoerung-im-bussgeldverfahren/New window Bußgeld
/fahrerflucht/New window Unfallflucht
/alkoholfahrt/New window Alkohol
/drogen-im-strassenverkehr/New window Drogen
/koerperverletzung-nach-verkeh...New window Körperverletzung
/verkehrsunfall/New window Verkehrsunfall
/schmerzensgeld-nach-einem-unf...New window Schmerzensgeld
/illegales-autorennen/New window Illegales Autorennen
/aeusserung-als-beschuldigter/Verkehrsstrafrecht
/anhoerung-im-bussgeldverfahren/New window Bußgeldverfahren
/fahrverbot-umgehen/New window Führerscheinsachen
/mpu-idiotentest/(MPU)
/regress-anwalt/New window Regressansprüche Ihrer Haftpflichtversicherung
/schadensregulierung-nach-eine...New window Schadensregulierung nach einem Unfall
/autokauf-von-privat-oder-haen...Autokauf und Ka
/autokauf-von-privat-oder-haen...New window u
/autokauf-von-privat-oder-haen...fvertrag
/fahrerflucht/New window Blogartikel zur Unfallflucht
/koerperverletzung-nach-verkeh...New window Blogartikel zur Körperverletzung nach Verkehrsunfall
/alkoholfahrt/New window Blogartikel zur Alkoholfahrt
/anhoerung-im-bussgeldverfahren/New window Blogartikel zum Bußgeldverfahren
/fahrverbot-umgehen/New window Blogartikel zum Fahrverbot
/regress-anwalt/New window Blogartikel zu Regressansprüche der Versicherung
/schadensregulierung-nach-eine...New window Blogartikel zur Schadensregulierung nach Unfall
/autokauf-von-privat-oder-haen...New window Blogartikel zum Autokauf und Kaufvertrag
/illegales-autorennen/Illegales Autorennen vorgeworfen
/anhoerung-im-bussgeldverfahren/New window Anhörung im Bußgeldverfahren
/zeugenfragebogen-ausfuellen/New window Zeugenfragebogen ausfüllen
/aeusserung-als-beschuldigter/New window Äußerung als Beschuldigter
/schaden-nach-einem-autounfall/New window Schaden nach einem Autounfall
/rote-ampel-ueberfahren/New window Rote Ampel überfahren
/abstand-nicht-eingehalten/New window Abstand nicht eingehalten
/zu-schnell-gefahren/New window Zu schnell gefahren
/koerperverletzung-nach-verkeh...New window Vorwurf Körperverletzung nach Verkehrsunfall
/fahrerflucht/New window Fahrerflucht
/alkoholfahrt/New window Alkoholfahrt vorgeworfen
/kontakt/zur Anfahrtsbeschreibung (hier klicken)
https://www.xing.com/profile/T...External Subdomain No Text
https://de.linkedin.com/in/tho...External Subdomain No Text
https://twitter.com/KanzleiErvenExternal No Text
https://www.facebook.com/Kanzl...External Subdomain No Text
https://jm1.eu/anwaltervenmapsExternal No Text
https://g.page/r/CaMudVOpw3svE...New window External IMG-ALT Google My Business Icon
/wp-content/uploads/2021/01/Vo...Vollmacht
IMG-ALT Hier ein PDF kannst du herunterladen
/wp-content/uploads/2016/01/de...New window "Schnee und Glatteis - wer haftet bei Unfällen im Straßenverkehr?"
http://www.deutschlandradio.de/New window External Subdomain Mit freundlicher Genehmigung vom Deutschlandradio.
https://www.ag-strafrecht.de/New window External Subdomain IMG-ALT Mitgliedschaft-Strafrecht
https://www.fachanwalt.de/maga...New window External Subdomain No Text
https://www.juraforum.de/New window External Subdomain IMG-ALT juraforum-logo-fachanwalt
https://www.anwalt.org/New window External Subdomain IMG-ALT anwalt.org
https://www.provenexpert.com/a...New window External Subdomain IMG-ALT Erfahrungen & Bewertungen zu Anwaltskanzlei Erven
A-TITLE Kundenbewertungen & Erfahrungen zu Anwaltskanzlei Erven. Mehr Infos anzeigen.
/datenschutzbestimmungen/Datenschutzbestimmungen
/impressum/Text duplicate Impressum
https://www.xing.com/profile/T...New window External Subdomain No Text
https://de.linkedin.com/in/tho...New window External Subdomain No Text
https://twitter.com/KanzleiErvenNew window External No Text
https://www.facebook.com/Kanzl...New window External Subdomain No Text
https://www.google.com/maps/pl...New window External Subdomain No Text
/kontakt/No Text
https://www.kanzlei-erven.de/Anchor No Text

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://www.kanzlei-erven.de/"
HTTP header
(Important)
No X-Powered HTTP header is sent.
The web server transmits the web page (HTML) in compressed form.
Performance
(Somewhat important)
The page response time of 0.74 seconds is longer than the recommended limit of 0.4 seconds. A high response time unnecessarily slows down search engine crawling and results in bad user experience as well.
The file size of the HTML document is fine (204 kB).

HTTP Response Header

NameValue
last-modifiedTue, 12 Aug 2025 11:20:09 GMT
cache-controlmax-age=0
expiresTue, 12 Aug 2025 17:02:48 GMT
varyAccept-Encoding,User-Agent
content-encodinggzip
content-typetext/html; charset=UTF-8
dateTue, 12 Aug 2025 17:02:48 GMT
serverApache
statuscode200
http_versionHTTP/2

External factors

This page has only a few links from other websites.
This page only has backlinks from 21 referring domains.
This page only has 64 backlinks.
This page only has few backlinks from 21 different ip addresses.

Links from Wikipedia

No links from Wikipedia were found.

Search preview

www.kanzlei-erven.de
Ihr Fachanwalt für Verkehrsrecht in Köln | Kanzlei Erven
▶️ TOP bewerteter Fachanwalt für Verkehrsrecht in Köln auf Google ✅ Hilfe bei Bußgeldverfahren, Fahrverbot, Unfallflucht u.v.m. ☎ 0221 301 403 44.

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
Verkehrsrecht86%Check
Fachanwalt Verkehrsrecht85%Check
Fachanwalt für Verkehrsrecht84%Check
Fachanwalt82%Check
Verkehrsrecht Köln80%Check
erven76%Check
Köln76%Check
Kanzlei Erven71%Check
Kanzlei65%Check
im Verkehrsrecht65%Check

Automatically check kanzlei-erven.de including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions