Actividadesdeinfantilyprimaria.com - SEO Checker

Sign up for free! PDF Export
Overview of the SEO Check
Meta information
73% 
Page quality
93% 
Page structure
79% 
Link structure
26% 
Server
75% 
External factors
54% 
SEO Score
Response time
0.75 s
File size
91.60 kB
Words
881
Media files
16
Number of links
178 internal / 5 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
The page title should be shorter than 580 pixels. It is 699 pixels long. Optimize title
There are word repetitions in the page title.
Meta description
(Critically important)
Recursos para trabajar en infantil y primaria
The length of the meta description is perfect. (271 pixels out of 1000 max pixel length)
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://www.actividadesdeinfantilyprimaria.com/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: es
Language defined in HTML: es
Server location: France
The following language is defined by HTML: es
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel prev meta tag on this page.
Rel next URL https://www.actividadesdeinfantilyprimaria.com/page/2/
The rel next and prev tags are set correctly.
Domain
(Somewhat important)
The domain name is very long.
The domain is no subdomain.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
viewportwidth=device-width, initial-scale=1
robotsindex, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1
descriptionRecursos para trabajar en infantil y primaria
generatorSite Kit by Google 1.157.0
google-adsense-platform-accountca-host-pub-2644536267352236
google-adsense-platform-domainsitekit.withgoogle.com
msapplication-TileImagehttps://i0.wp.com/www.actividadesdeinfantilyprimaria.com/wp-content/uploads/2017/04/cropped-favicon.png?fit=270%2C270&ssl=1
langes
twitter:cardsummary
twitter:titleActividades de infantil y primaria
twitter:descriptionRecursos para trabajar en infantil y primaria
og:titleActividades de infantil y primaria
og:descriptionRecursos para trabajar en infantil y primaria
og:typewebsite
og:urlhttps://www.actividadesdeinfantilyprimaria.com/
og:site_nameActividades de infantil y primaria
nexthttps://www.actividadesdeinfantilyprimaria.com/page/2/
charsetUTF-8

Automatically check actividadesdeinfantilyprimaria.com including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Page quality

Content
(Critically important)
The average number of words per sentence of 25.33 words is high.
This page contains 881 words. That's ok.
26.2% of the text are stop words.
Keywords used in the page title are also used in the page content. That's good!
Words from the H1 heading are used in the page content.
The page contains a listing, which indicates a good text layout.
9 paragraphs were found on this page.
The text content is perfect.
No placeholders texts or images were found.
There are no duplicates on the site.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
A viewport "width=device-width, initial-scale=1" is provided.
At least one Apple touch icon is specified.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 18 tags for this page.
Image SEO
(Somewhat important)
8 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
This page is optimized perfectly for social networks.
Additional markup
(Nice to have)
This page uses Google authorship information without an image.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
...ada-memory-helados.png?fit=300,157&ssl=1No alt attribute provided
...emocionales-agosto.jpg?fit=300,169&ssl=1No alt attribute provided
...5/07/libros-verano.png?fit=300,200&ssl=1No alt attribute provided
...11/portada-silabas.png?fit=300,157&ssl=1No alt attribute provided
...amiliares-agosto-1.jpg?fit=300,169&ssl=1No alt attribute provided
...-PARTE-1_page-0008.jpg?fit=300,169&ssl=1No alt attribute provided
...rtada-busco-letras.jpg?fit=300,169&ssl=1No alt attribute provided
...tematicas-agosto-1.jpg?fit=300,169&ssl=1No alt attribute provided
...ch-1.jpg?fit=1200,848&ssl=1&resize=40,40Los días de la semana con Lilo y Stitch
...itch.png?fit=1150,600&ssl=1&resize=40,40Bonita colección de dibujos para colorear de Lilo y Stitch
...ones.png?fit=1150,600&ssl=1&resize=40,40Precioso cuaderno de actividades para trabajar las emociones y su identificación
...delo.png?fit=1150,600&ssl=1&resize=40,40Dibujos de Lilo y Stitch para colorear siguiendo el modelo
...CIAL.png?fit=1150,600&ssl=1&resize=40,40Lecturitas sencillas para trabajar la comprensión lectora en nivel inicial
/wp-content/uploads/2019/03/verificada.pngCertificado de Calidad Online
/wp-content/uploads/2019/03/logo-cafe1.pngDesarrollo web
...tivecommons.org/l/by-nc-sa/3.0/88x31.pngLicencia Creative Commons

Page structure

H1 heading
(Critically important)
Actividades de infantil y primaria
The H1 heading is perfect.
Headings
(Important)
The structure of headings is missing one or more levels. Do not skip heading levels.

Heading structure

Heading levelContent
H1 Actividades de infantil y primaria
H2 Divertido juego de atención y memoria: El memory de los helados
H2 Calendario de actividades emocionales para el mes de agosto
H2 Recomendaciones de lectura para las vacaciones
H2 Fichas forma sílabas en mayúscula y minúscula con todas las letras del abecedario
H2 Calendario de actividades familiares para el mes de agosto 2025
H2 Colección de cuadernitos para trabajar la lectoescritura de las vocales
H2 Busca y encuentra palabras con diferentes números de letras
H2 Calendario de actividades matemáticas para el mes de agosto 2025
H4 Suscribete
H4 SIGUE NUESTROS TABLEROS EN PINTEREST
H4 LO MÁS VISITADO
Some anchor texts are used more than once.
8 links don't have an anchor text.
The number of internal links is ok.
None of the anchor texts is too long.
All internal links are not using dynamic parameters.
There are 5 external links on this page.

Found links on this page

LinkAttributesAnchor text
/Actividades de infantil y primaria
/Inicio
/category/final-de-curso/Final de Curso
/category/educacion-infantil/Infantil
/category/educacion-infantil/3...3 Años
/category/educacion-infantil/3...Grafomotricidad
/category/educacion-infantil/3...Lectoescritura
/category/educacion-infantil/4...Literatura infantil
/category/educacion-infantil/3...Lógico-Matemática
/category/educacion-infantil/3...Plástica y creatividad
/category/educacion-infantil/4...4 Años
/category/educacion-infantil/4...Text duplicate Grafomotricidad
/category/educacion-infantil/4...Text duplicate Lectoescritura
/category/educacion-infantil/3...Text duplicate Literatura infantil
/category/educacion-infantil/4...Text duplicate Lógico-Matemática
/category/educacion-infantil/4...Text duplicate Plástica y creatividad
/category/educacion-infantil/5...5 Años
/category/educacion-infantil/5...Text duplicate Grafomotricidad
/category/educacion-infantil/5...Text duplicate Lectoescritura
/category/educacion-infantil/5...Text duplicate Literatura infantil
/category/educacion-infantil/5...Text duplicate Lógico-Matemática
/category/educacion-infantil/5...Text duplicate Plástica y creatividad
/category/educacion-primaria/Primaria
/category/comprension-lectora/Comprensión Lectora
/category/educacion-primaria/p...Primer Ciclo
/category/educacion-primaria/p...Matemáticas
/category/educacion-primaria/p...Lengua
/category/educacion-primaria/p...Ciencias Sociales
/category/educacion-primaria/p...Ciencias Naturales
/category/educacion-primaria/s...Segundo Ciclo
/category/educacion-primaria/s...Text duplicate Matemáticas
/category/educacion-primaria/s...Text duplicate Lengua
/category/educacion-primaria/s...Text duplicate Ciencias Sociales
/category/educacion-primaria/s...Text duplicate Ciencias Naturales
/category/educacion-primaria/t...Tercer Ciclo
/category/educacion-primaria/t...Text duplicate Matemáticas
/category/educacion-primaria/t...Text duplicate Ciencias Sociales
/category/educacion-primaria/t...Text duplicate Lengua
/category/educacion-primaria/t...Text duplicate Ciencias Naturales
/category/neae/NEAE
/category/atencion/Atención
/author/maria/María
/2025/07/25/divertido-juego-de...Anchor Deja un comentario
/2025/07/25/divertido-juego-de...Divertido juego de atención y memoria: El memory de los helados
/2025/07/25/divertido-juego-de...No Text
/category/atencion/Text duplicate Atención
/category/juegos-educativos/Juegos educativos
/category/memoria/Memoria
/category/dias-especiales/verano/Verano
/tag/helados/helados
/tag/juego-de-atencion/juego de atención
/tag/juego-de-memoria/juego de memoria
/tag/juego-educativo/juego educativo
/tag/memory/memory
/tag/verano/verano
/author/maria/Text duplicate María
/2025/07/25/calendario-de-acti...Anchor Text duplicate Deja un comentario
/2025/07/25/calendario-de-acti...Calendario de actividades emocionales para el mes de agosto
/2025/07/25/calendario-de-acti...No Text
/category/calendarios/Calendarios
/category/educacion-emocional/Educación Emocional
/tag/actividades-emocionales/actividades emocionales
/tag/agosto/agosto
/tag/calendario-de-actividades/calendario de actividades
/tag/educacion-emocional/educación emocional
/tag/emociones/emociones
/tag/inteligencia-emocional/inteligencia emocional
/author/maria/Text duplicate María
/2025/07/24/recomendaciones-de...Anchor Text duplicate Deja un comentario
/2025/07/24/recomendaciones-de...Recomendaciones de lectura para las vacaciones
/2025/07/24/recomendaciones-de...No Text
/category/comprension-lectora/Comprensión lectora
/category/comprension-lectora/...Lecturas comprensivas y cuentos
/tag/lectura-recomendada/lectura recomendada
/tag/libros/libros
/tag/para-docentes/para docentes
/tag/para-padres-y-madres/para padres y madres
/tag/recomendaciones/recomendaciones
/author/maria/Text duplicate María
/2025/07/24/fichas-forma-silab...Anchor Text duplicate Deja un comentario
/2025/07/24/fichas-forma-silab...Fichas forma sílabas en mayúscula y minúscula con todas las letras del abecedario
/2025/07/24/fichas-forma-silab...No Text
/category/educacion-infantil/3...Text duplicate 3 Años
/category/educacion-infantil/4...Text duplicate 4 Años
/category/educacion-infantil/5...Text duplicate 5 Años
/category/educacion-infantil/Educación Infantil
/category/educacion-infantil/5...Text duplicate Lectoescritura
/category/educacion-infantil/4...Text duplicate Lectoescritura
/category/educacion-infantil/3...Text duplicate Lectoescritura
/tag/competencia-linguistica/Competencia lingüística
/tag/educacion-infantil/educación infantil
/tag/educacion-preescolar/educación preescolar
/tag/formar-silabas/formar sílabas
/tag/lectoescritura/lectoescritura
/tag/lengua-primaria/lengua primaria
/tag/mayuscula/mayúscula
/tag/minuscula/minúscula
/author/maria/Text duplicate María
/2025/07/24/calendario-de-acti...Anchor Text duplicate Deja un comentario
/2025/07/24/calendario-de-acti...Calendario de actividades familiares para el mes de agosto 2025
/2025/07/24/calendario-de-acti...No Text
/category/calendarios/Text duplicate Calendarios
/category/dias-especiales/Días especiales
/category/dias-especiales/verano/Text duplicate Verano
/tag/actividades-familiares/actividades familiares
/tag/agosto/Text duplicate agosto
/tag/calendario/calendario
/tag/dinamica/dinámica
/tag/dinamicas-familiares/dinámicas familiares
/tag/familia/familia
/tag/vacaciones/vacaciones
/tag/vacaciones-de-verano/vacaciones de verano
/author/maria/Text duplicate María
/2025/07/23/coleccion-de-cuade...Anchor Text duplicate Deja un comentario
/2025/07/23/coleccion-de-cuade...Colección de cuadernitos para trabajar la lectoescritura de las vocales
/2025/07/23/coleccion-de-cuade...No Text
/category/educacion-infantil/4...Text duplicate 4 Años
/category/educacion-infantil/5...Text duplicate 5 Años
/category/educacion-infantil/Text duplicate Educación Infantil
/category/educacion-infantil/5...Text duplicate Lectoescritura
/category/educacion-infantil/4...Text duplicate Lectoescritura
/category/neae/Text duplicate NEAE
/tag/competencia-linguistica/Text duplicate Competencia lingüística
/tag/cuaderno-de-actividades/cuaderno de actividades
/tag/cuaderno-de-trabajo/Cuaderno de trabajo
/tag/educacion-infantil/Text duplicate educación infantil
/tag/educacion-preescolar/Text duplicate educación preescolar
/tag/lectoescritura/Text duplicate lectoescritura
/tag/neae/Text duplicate NEAE
/tag/vocales/vocales
/author/maria/Text duplicate María
/2025/07/23/busca-y-encuentra-...Anchor Text duplicate Deja un comentario
/2025/07/23/busca-y-encuentra-...Busca y encuentra palabras con diferentes números de letras
/2025/07/23/busca-y-encuentra-...No Text
/category/dislexia/Dislexia
/category/educacion-primaria/Educación Primaria
/category/educacion-primaria/s...Text duplicate Lengua
/category/educacion-primaria/p...Text duplicate Lengua
/category/educacion-primaria/p...Text duplicate Primer Ciclo
/category/educacion-primaria/s...Text duplicate Segundo Ciclo
/tag/competencia-linguistica/Text duplicate Competencia lingüística
/tag/dislexia/dislexia
/tag/lectoescritura/Text duplicate lectoescritura
/tag/lengua-primaria/Text duplicate lengua primaria
/author/maria/Text duplicate María
/2025/07/23/calendario-de-acti...Anchor Text duplicate Deja un comentario
/2025/07/23/calendario-de-acti...Calendario de actividades matemáticas para el mes de agosto 2025
/2025/07/23/calendario-de-acti...No Text
/category/educacion-primaria/Text duplicate Educación Primaria
/category/educacion-primaria/p...Text duplicate Matemáticas
/category/educacion-primaria/s...Text duplicate Matemáticas
/category/educacion-primaria/p...Text duplicate Primer Ciclo
/category/educacion-primaria/s...Text duplicate Segundo Ciclo
/tag/actividades-matematicas/actividades matemáticas
/tag/agosto/Text duplicate agosto
/tag/calendario-de-actividades/Text duplicate calendario de actividades
/tag/competencia-matematica/Competencia matemática
/tag/matematicas-divertidas/matemáticas divertidas
/tag/matematicas-primaria/matemáticas primaria
/1
/page/2/2
/page/3/3
/page/726/726
/page/2/Página siguiente »
https://es.pinterest.com/activ...External Subdomain No Text
https://www.facebook.com/activ...External Subdomain No Text
/2025/07/19/los-dias-de-la-sem...IMG-ALT Los días de la semana con Lilo y Stitch
A-TITLE Los días de la semana con Lilo y Stitch
/2025/07/19/los-dias-de-la-sem...Text duplicate Los días de la semana con Lilo y Stitch
A-TITLE Los días de la semana con Lilo y Stitch
/2025/06/14/bonita-coleccion-d...IMG-ALT Bonita colección de dibujos para colorear de Lilo y Stitch
A-TITLE Bonita colección de dibujos para colorear de Lilo y Stitch
/2025/06/14/bonita-coleccion-d...Text duplicate Bonita colección de dibujos para colorear de Lilo y Stitch
A-TITLE Bonita colección de dibujos para colorear de Lilo y Stitch
/2025/07/16/precioso-cuaderno-...IMG-ALT Precioso cuaderno de actividades para trabajar las emociones y su identificación
A-TITLE Precioso cuaderno de actividades para trabajar las emociones y su identificación
/2025/07/16/precioso-cuaderno-...Text duplicate Precioso cuaderno de actividades para trabajar las emociones y su identificación
A-TITLE Precioso cuaderno de actividades para trabajar las emociones y su identificación
/2025/06/22/dibujos-de-lilo-y-...IMG-ALT Dibujos de Lilo y Stitch para colorear siguiendo el modelo
A-TITLE Dibujos de Lilo y Stitch para colorear siguiendo el modelo
/2025/06/22/dibujos-de-lilo-y-...Text duplicate Dibujos de Lilo y Stitch para colorear siguiendo el modelo
A-TITLE Dibujos de Lilo y Stitch para colorear siguiendo el modelo
/2023/05/03/lecturas-sencillas...IMG-ALT Lecturitas sencillas para trabajar la comprensión lectora en nivel inicial
A-TITLE Lecturitas sencillas para trabajar la comprensión lectora en nivel inicial
/2023/05/03/lecturas-sencillas...Text duplicate Lecturitas sencillas para trabajar la comprensión lectora en nivel inicial
A-TITLE Lecturitas sencillas para trabajar la comprensión lectora en nivel inicial
/Text duplicate Inicio
/aviso-legal/Aviso Legal
/contacto/Contacto
/www.actividadesdeinfantilypri...www.actividadesdeinfantilyprimaria.com
A-TITLE activiades de infantil y primaria
https://www.verificada.com/adh...New window External Subdomain IMG-ALT Certificado de Calidad Online
A-TITLE Certificado de calidad web
https://www.grupocafe.es/New window External Subdomain IMG-ALT Desarrollo web
A-TITLE Desarrollo web
https://creativecommons.org/li...New window External IMG-ALT Licencia Creative Commons

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://www.actividadesdeinfantilyprimaria.com/"
HTTP header
(Important)
The web server version is sent within the HTTP header.
No X-Powered HTTP header is sent.
The web server transmits the web page (HTML) in compressed form.
Performance
(Somewhat important)
The page response time of 0.75 seconds is longer than the recommended limit of 0.4 seconds. A high response time unnecessarily slows down search engine crawling and results in bad user experience as well.
The file size of the HTML document is fine (92 kB).

HTTP Response Header

NameValue
servernginx/1.18.0 (Ubuntu)
dateSat, 26 Jul 2025 13:13:34 GMT
content-typetext/html; charset=UTF-8
varyAccept-Encoding
link<https://www.actividadesdeinfantilyprimaria.com/wp-json/>; rel="https://api.w.org/"
access-control-allow-origin*
content-encodinggzip
statuscode200
http_versionHTTP/2

External factors

This page has only a few links from other websites.
This page only has backlinks from 18 referring domains.
This page only has 778 backlinks.
This page only has few backlinks from 17 different ip addresses.

Links from Wikipedia

No links from Wikipedia were found.

Robots.txt

No valid Robots.txt file was found.

Similar sites

Search preview

www.actividadesdeinfantilyprimaria.com
Actividades de infantil y primaria - Recursos para trabajar en infa...
Recursos para trabajar en infantil y primaria

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
primaria87%Check
infantil87%Check
Actividades de infantil84%Check
Actividades81%Check
de actividades81%Check
en infantil78%Check
trabajar en infantil73%Check
Calendario de actividades69%Check
cuaderno de actividades68%Check
de agosto63%Check
Show more keywords and terms

Automatically check actividadesdeinfantilyprimaria.com including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

Contact | Privacy

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions