Fcvolendam.nl - SEO Checker

Overview of the SEO Check
Meta information
84% 
Page quality
36% 
Page structure
95% 
Link structure
43% 
Server
90% 
External factors
100% 
SEO Score
Response time
0.41 s
File size
41.10 kB
Words
378
Media files
77
Number of links
120 internal / 61 external

Task list of SEO Improvements

Meta specifications

Title
(Critically important)
FC Volendam
The page title is too short. (121 pixels of 580 max pixel length) Optimize title
There are no duplicate words in the title
Meta description
(Critically important)
TEKTS TICKET BUTTON WAS: TICKETS LINK WAS: https://tickets.fcvolendam.nl/dashboard Scoor nu je tickets! Scoor nu je seizoenkaart!..
The length of the meta description is perfect. (868 pixels out of 1000 max pixel length)
Crawlability
(Critically important)
There are no problems in accessing the website.
Canonical URL
(Important)
https://fcvolendam.nl/
There is a valid canonical link specified.
Language
(Somewhat important)
Language detected in text: nl
Language defined in HTML: nl
Server location: Canada
The following language is defined by HTML: nl
Alternate/Hreflang Links
(Somewhat important)
There are no alternate links specified on this page.
Other meta tags
(Somewhat important)
There is no rel next meta tag on this page.
There is no rel prev meta tag on this page.
Domain
(Somewhat important)
The domain is no subdomain.
The domain length is good.
The domain does not contain non-latin characters.
Page URL
(Somewhat important)
No parameters were found in the URL.
No session ID was found in the URL.
The URL does not have too many subdirectories.
Charset encoding
(Somewhat important)
The charset encoding (UTF-8) is set correctly.
Doctype
(Nice to have)
The doctype HTML 5 is set correctly.
The doctype is placed at first in the HTML code.
Favicon
(Nice to have)
The favicon is linked correctly.

Meta tags

NameValue
authorStudioweb.nl
viewportwidth=device-width, initial-scale=1, maximum-scale=1, user-scalable=0
keywordsEmpty
descriptionTEKTS TICKET BUTTON WAS: TICKETS   LINK WAS: https://tickets.fcvolendam.nl/dashboard     Scoor nu je tickets! Scoor nu je seizoenkaart!..
imageEmpty
robotsnoodp, noydir, index, follow, archive
langnl
twitter:cardsummary_large_image
twitter:site@fcvolendam_official
twitter:titleFC Volendam
twitter:urlhttps://fcvolendam.nl/
twitter:descriptionTEKTS TICKET BUTTON WAS: TICKETS   LINK WAS: https://tickets.fcvolendam.nl/dashboard     Scoor nu je tickets! Scoor nu je seizoenkaart!..
twitter:imageEmpty
og:site_nameFC Volendam
og:titleFC Volendam
og:urlhttps://fcvolendam.nl/
og:descriptionTEKTS TICKET BUTTON WAS: TICKETS   LINK WAS: https://tickets.fcvolendam.nl/dashboard     Scoor nu je tickets! Scoor nu je seizoenkaart!..
og:typewebsite
og:imageEmpty
X-UA-CompatibleIE=edge
charsetUTF-8

Automatically check fcvolendam.nl including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Page quality

Content
(Critically important)
Words from the H1 heading are not used in the page content.
No paragraphs were detected.
There are only 378 words on this page. Good pages should have about 800 words of useful content.
10.8% of the text are stop words.
The page contains a listing, which indicates a good text layout.
No placeholders texts or images were found.
Frames
(Critically important)
This page does not use a frameset.
Mobile optimization
(Somewhat important)
No Apple touch icon is specified.
A viewport "width=device-width, initial-scale=1, maximum-scale=1, user-scalable=0" is provided.
Bold and strong tags
(Somewhat important)
The usage of strong and bold tags is perfect. We recommend the use of up to 8 tags for this page.
Image SEO
(Somewhat important)
65 images have no alt attribute. The content of alt attributes is used by search engines.
Social Networks
(Nice to have)
There are only a few social sharing widgets on the page. Make your website popular in social networks with social sharing widgets.
Additional markup
(Nice to have)
No additional page markup was found.
HTTPS
(Somewhat important)
This website uses HTTPS to protect privacy and integrity of the exchanged data.
All included files are also transferred via HTTPS.

Media list

URLAlt attributeTitle
/site-fcvd/assets/img/logo.pngNo alt attribute providedFC Volendam
/site-fcvd/assets/img/sw-logo.pngNo alt attribute provided
/site-fcvd/assets/img/logo.pngNo alt attribute providedFC Volendam
...cvd/assets/img/logo-eredivisie-white.pngNo alt attribute provided
...vd/storage/files/16683/sc_heerenveen.pngNo alt attribute provided
.../storage/files/1381/logo-fc-volendam.pngNo alt attribute provided
...6556/500_x_400_thumb_website.500x400.jpgNo alt attribute provided
...5870/500_x_400_thumb_website.500x400.jpgNo alt attribute provided
...iles/36138/thumbnail_cocomat.500x400.pngNo alt attribute provided
...57/500_x_400_thumb_website_2.500x400.jpgNo alt attribute provided
...19/500_x_400_thumb_website_1.500x400.jpgNo alt attribute provided
...rage/files/35960/grasactie_a_590x624.jpgNo alt attribute provided
...rage/files/35960/grasactie_b_608x638.jpgNo alt attribute provided
...6137/500_x_400_thumb_website.500x400.pngNo alt attribute provided
...6136/500_x_400_thumb_website.500x400.pngNo alt attribute provided
...les/8820/espn_goal_alert_vol_590x624.pngNo alt attribute provided
...les/8820/espn_goal_alert_vol_608x638.pngNo alt attribute provided
...eizen_algemeen_fc_volendam_340_x_946.pngNo alt attribute provided
...eizen_algemeen_fc_volendam_340_x_946.pngNo alt attribute provided
...on_onlinetickets_500x360_jpg.500x360.jpgNo alt attribute provided
...d/storage/files/9457/contact.500x360.jpgNo alt attribute provided
...riendenloterijeredivisie_jpg.500x360.jpgNo alt attribute provided
...4/button_webshop_500x360_jpg.500x360.jpgNo alt attribute provided
...orage/files/36592/thumb-site.600x338.jpgNo alt attribute provided
...es/36549/thumb-site-open-dag.600x338.jpgNo alt attribute provided
...e/files/36538/thumb-roy-site.600x338.jpgNo alt attribute provided
...iles/36533/samenvatting-site.600x338.jpgNo alt attribute provided
...orage/files/16537/eredivisie.300x200.jpgNo alt attribute provided
...rage/files/32823/derbystar-1.300x200.jpgNo alt attribute provided
...fcvd/storage/files/8425/epsn.300x200.jpgNo alt attribute provided
...cvd/storage/files/36349/plus.300x200.jpgNo alt attribute provided
.../files/16538/vriendenloterij.300x200.jpgNo alt attribute provided
...-fcvd/storage/files/1085/hsb.300x200.jpgNo alt attribute provided
...d/storage/files/36301/mascot.300x200.jpgNo alt attribute provided
...fcvd/storage/files/1086/kras.300x200.jpgNo alt attribute provided
...storage/files/7327/podobrace.300x200.jpgNo alt attribute provided
...storage/files/1577/kwakman-1.300x200.jpgNo alt attribute provided
.../storage/files/19420/timbo-1.300x200.jpgNo alt attribute provided
...cvd/storage/files/36302/duka.300x200.jpgNo alt attribute provided
...vd/storage/files/14293/robey.300x200.jpgNo alt attribute provided
...age/files/11931/bakkertravel.300x200.jpgNo alt attribute provided
...age/files/36303/bdcontainers.300x200.jpgNo alt attribute provided
...storage/files/1185/logo-boko.300x200.jpgNo alt attribute provided
...vd/storage/files/20361/daiwa.300x200.jpgNo alt attribute provided
...age/files/14548/degraafafval.300x200.jpgNo alt attribute provided
...d/storage/files/1313/drgroup.300x200.jpgNo alt attribute provided
...bsite_spelersponsoring_800px.300x200.pngNo alt attribute provided
...orage/files/1217/groenhart-1.300x200.jpgNo alt attribute provided
...vd/storage/files/1218/hansel.300x200.jpgNo alt attribute provided
...torage/files/1566/heineken00.300x200.jpgNo alt attribute provided
...-fcvd/storage/files/1237/kbk.300x200.jpgNo alt attribute provided
...torage/files/12491/zwarthoed.300x200.jpgNo alt attribute provided
...fcvd/storage/files/1240/kivo.300x200.jpgNo alt attribute provided
...er_seafood-and-oriental-food.300x200.pngNo alt attribute provided
...torage/files/7322/pietklerkx.300x200.jpgNo alt attribute provided
...d/storage/files/7329/postuma.300x200.jpgNo alt attribute provided
.../storage/files/1273/rabobank.300x200.jpgNo alt attribute provided
...-fcvd/storage/files/1580/tma.300x200.jpgNo alt attribute provided
...cvd/storage/files/1309/vab-1.300x200.jpgNo alt attribute provided
...torage/files/20364/vanmossel.300x200.jpgNo alt attribute provided
...iles/20363/vdh-solar_website.300x200.jpgNo alt attribute provided
...vd/storage/files/29575/vdk-1.300x200.jpgNo alt attribute provided
...storage/files/33584/volare-1.300x200.jpgNo alt attribute provided
.../1/uittenue2025-2026_popup-wedstrijd.jpgNo alt attribute provided
/site-fcvd/assets/img/logo.pngNo alt attribute providedFC Volendam
...ge/files/13016/onlinesponsor_number1.pngnumber1-voetbalreizen.nl
...age/files/13017/voetbalticketshop_nl.pngvoetbalticketshop.nl
.../13018/onlinesponsor_voetbalreizenxl.pngvoetbalreizenxl.nl
...iles/25373/onlinesponsor_pst_300x200.pngpremium-sportstravel.nl/
...56/uitvaartverzekeringvergelijkencom.pnguitvaartverzekeringvergelijken.com
...-fcvd/storage/files/33029/photobooth.pngphotobooth.com
...fcvd/storage/files/33030/onderneming.pngOnderneming.nl
...cvd/storage/files/33031/bankrekening.pngBankrekening.nl
...cvd/storage/files/33032/zakelijkgeld.pngZakelijkgeld.nl
...ge/files/35280/transfermarktnlwedden.pngtransfermarkt.nl/wedden/
...d/storage/files/35281/weddenbonuscom.pngweddenbonus.com
/site-fcvd/storage/files/36583/ofsgroep.pngOFSgroep

Page structure

H1 heading
(Critically important)
FCVD Actueel
The H1 heading is too short (12 characters). It should be at least 20 Characters long.
Headings
(Important)
The heading structure is perfect.

Heading structure

Heading levelContent
H1 FCVD Actueel
H2 FC Volendam TV
H3 Divisiepartners
H3 Shirtsponsoren
H3 Premium Partners
Some anchor texts are used more than once.
1 links don't have an anchor text.
The number of internal links is ok.
None of the anchor texts is too long.
All internal links are not using dynamic parameters.
There are too many external links (61) on this page.
LinkAttributesAnchor text
https://fcvolendam.nl/No Text
https://fcvolendam.nl/voetbal/Voetbal
https://fcvolendam.nl/zakelijk/Zakelijk
https://fcvolendam.nl/kidsclub/Kidsclub
/kras-stadion/Kras Stadion
https://fcvolendam.nl/club/Club
/maatschappelijk/Maatschappelijk
https://fcvolendam.nl/webshop/New window Webshop
https://fcvolendam.nl/tickets/New window Ticketverkoop
https://fcvolendam.nl/tv/FC Volendam TV
/nieuwsbrief/Nieuwsbrief
https://fcvolendam.nl/contact/Contact
https://www.studioweb.nl/?utm_...New window External Subdomain No Text
/voetbal/nieuws/Nieuws
/voetbal/1e-elftal/1e Elftal
/voetbal/1e-elftal/selectie/Selectie
/voetbal/1e-elftal/wedstrijdve...Wedstrijdverslagen
/voetbal/1e-elftal/programma/Programma & Uitslagen
/voetbal/1e-elftal/stand/Stand
/voetbal/jong-volendam/Jong FC Volendam
/voetbal/jong-volendam/selectie/Text duplicate Selectie
/voetbal/jong-volendam/wedstri...Text duplicate Wedstrijdverslagen
/voetbal/jong-volendam/programma/Text duplicate Programma & Uitslagen
/voetbal/jong-volendam/stand/Text duplicate Stand
/voetbal/fc-volendam-o19/FC Volendam O19
/voetbal/fc-volendam-o19/progr...Text duplicate Programma & Uitslagen
/voetbal/fc-volendam-o19/stand/Text duplicate Stand
/voetbal/jeugdacademie/Jeugdacademie
/voetbal/jeugdacademie/bovenbouw/Bovenbouw
/voetbal/jeugdacademie/middenb...Middenbouw
/voetbal/jeugdacademie/onderbouw/Onderbouw
/voetbal/jeugdacademie/plannin...Planning Jeugd Voetbal Volendam
/voetbal/jeugdacademie/vertrou...Vertrouwenscontactpersoon
/voetbal/jeugdacademie/jezelf-...Jezelf onder aandacht brengen
/voetbal/agenda/Agenda & uitslagen
/zakelijk/nieuws1/Text duplicate Nieuws
/zakelijk/vergaderruimtes/Vergaderruimtes
/zakelijk/dineren/Dineren
/zakelijk/onze-sponsoren/Onze sponsoren
/zakelijk/businessclub-het-and...Businessclub 'Het Andere Oranje'
/zakelijk/club-van-200/Club van 200
/zakelijk/overige-sponsormogel...Overige Sponsormogelijkheden
/zakelijk/overige-sponsormogel...Spelersponsoring
/zakelijk/overige-sponsormogel...Webbannering
/zakelijk/overige-sponsormogel...Logovermelding Businessbordes
/zakelijk/overige-sponsormogel...Narrowcasting
/zakelijk/skyboxen/Skyboxen
/zakelijk/fc-volendam-stadiont...Stadiontour FC Volendam
/kras-stadion/algemene-informa...Algemene Informatie
/kras-stadion/bereikbaarheid/Bereikbaarheid & Parkeren
/kras-stadion/fanshop/Fanshop
/kras-stadion/huisregels-fc-vo...Huisregels FC Volendam
/kras-stadion/fc-volendam-stad...FC Volendam Stadiontour
/club/supporterszaken/Supporterszaken
/club/perszaken/Mediabeleid
/club/organisatie/Organisatie
/club/vacatures/Vacatures en stages
/club/veilig-sportklimaat/Veilig sportklimaat
/maatschappelijk/projecten/Projecten
/maatschappelijk/projecten/ora...MDT-traject: Orange Talent
/maatschappelijk/projecten/old...Old Stars
/maatschappelijk/projecten/won...WonderboyZ
/maatschappelijk/projecten/oud...Oud-spelers
/maatschappelijk/maatschappeli...Partners
/maatschappelijk/maatschappeli...Pole Position
/maatschappelijk/maatschappeli...Nederlands Transplantatie Team
/maatschappelijk/maatschappeli...Gemeente Edam-Volendam
/tickets/seizoenkaarten-1/Seizoenkaart
/tickets/dagkaarten/New window Dagkaarten
/tickets/standaardvoorwaarden-...Standaardvoorwaarden KNVB
/tickets/busregels-uitwedstrij...Busregels uitwedstrijden
https://fcvolendam.nl/No Text
/nieuws/vdh-navetto-verlengt-m...No Text
https://eredivisie.nl/New window External No Text
https://tickets.fcvolendam.nl/...New window External Subdomain SCOOR JE TICKETS
/nieuws/vdh-navetto-verlengt-m...21 jul VDH Navetto verlengt met trots het sponsorschap van FC Volendam
/nieuws/voorbereiding-nac-bred...19 jul Voorbereiding: NAC Breda volgende horde na geslaagd trainingskamp
/wedstrijdnieuws/volendammers-...19 jul Volendammers sluiten trainingskamp af met gelijkspel tegen Norwich City
/nieuws/fc-volendam-en-runderk...18 jul FC Volendam en Runderkamp Catering langer met elkaar door
/nieuws/fc-volendam-en-number-...17 jul FC Volendam en Number 1 Voetbalreizen bundelen krachten voor unieke hospitality-arrangementen
https://steunfcvolendam.nl/?ut...New window External A-TITLE Grasactie Banner
/wedstrijdnieuws/volendammers-...16 jul Volendammers boeken zakelijke overwinning op oefenpartner Regioteam Schouwen-Duiveland
/wedstrijdnieuws/fc-volendam-m...12 jul FC Volendam zet met nipte zege op RKAV Volendam kers op Volendams voetbalfeest
https://www.espn.nl/?utm_sourc...New window External Subdomain A-TITLE ESPN
https://vi-travel.nl/?utm_sour...New window External A-TITLE VI Travel
https://fcvolendam.nl/nieuws/Meer nieuws
https://fcvolendam.nl/tickets/New window Online tickets
https://fcvolendam.nl/contact/New window Text duplicate Contact
/voetbal/1e-elftal/programma/Programma FCVD
https://fcvolendam.nl/webshop/New window Text duplicate Webshop
https://fcvolendam.nl/WqDl1FNQ8LISamenvatting FC Volendam - Norwich City 19 jul
https://youtu.be/Fo_m5PphtckExternal Aftermovie Corendon Open Dag 2025 14 jul
https://youtu.be/ACh4OkQ49dEExternal Roy Steur na RKAV Volendam - FC Volendam 13 jul
https://youtu.be/30agbCsWXMoExternal Samenvatting RKAV Volendam - FC Volendam (Oefenwedstrijd 2025 - 2026) 12 jul
https://fcvolendam.nl/tv/Meer FC Volendam TV
https://www.eredivisie.nl/?utm...New window External Subdomain A-TITLE Eredivisie
https://www.derbystar.nl/?utm_...New window External Subdomain A-TITLE Derbystar
https://www.espn.nl/?utm_sourc...New window External Subdomain Text duplicate A-TITLE ESPN
https://www.plus.nl/?utm_sourc...New window External Subdomain A-TITLE Plus
https://www.vriendenloterij.nl...New window External Subdomain A-TITLE VriendenLoterij
https://www.hsb-volendam.nl/?u...New window External Subdomain A-TITLE HSB Bouw
https://www.mascot.nl/nl?utm_s...New window External Subdomain A-TITLE Mascot Workwear
http://www.kras-recycling.com/...New window External Subdomain A-TITLE Kras Recycling
https://www.podobrace.nl/?utm_...New window External Subdomain A-TITLE Podobrace
https://kwakmangroep.nl/?utm_s...New window External A-TITLE Kwakman Groep
https://timbo-afrika-foundatio...New window External A-TITLE Stichting Timbo Afrika
https://dukametal.nl/?utm_sour...New window External A-TITLE Duka Metal Design
https://www.robeysportswear.co...New window External Subdomain A-TITLE Robey Sportswear
https://www.bakkertravel.nl/?u...New window External Subdomain A-TITLE Bakker Travel
https://bdcontainers.com/?utm_...New window External A-TITLE BD Containers
http://www.boko.nl/?utm_source...New window External Subdomain A-TITLE BOKO Dakbedekkers
https://jansnel.com/?utm_sourc...New window External A-TITLE Daiwa House
https://graafgroep.nl/?utm_sou...New window External A-TITLE De Graaf Afvalbeheer
http://www.vandongederoo.com/?...New window External Subdomain A-TITLE Van Donge & De Roo
https://www.gomes.nl/?utm_sour...New window External Subdomain A-TITLE Gomes Mercedes-Benz
https://www.groenhart.nl/?utm_...New window External Subdomain A-TITLE Groenhart
http://www.hansel.nl/?utm_sour...New window External Subdomain A-TITLE Hansel Salades en Sauzen
https://www2.heineken.com/nl/o...New window External Subdomain A-TITLE Heineken
https://www.kbkbouwgroep.nl/?u...New window External Subdomain A-TITLE KBK bouwgroep
http://www.kirry.nl/?utm_sourc...New window External Subdomain A-TITLE Tegelshowroom Zwarthoed-Kirry
https://www.kivo.nl/?utm_sourc...New window External Subdomain A-TITLE Kivo Plastic Verpakkingen
http://www.mooijer.nl/?utm_sou...New window External Subdomain A-TITLE Mooijer Volendam BV
https://www.pietklerkx.nl/?utm...New window External Subdomain A-TITLE Piet Klerkx
http://postuma.nl/?utm_source=...New window External A-TITLE Postuma AGF
https://www.rabobank.nl/partic...New window External Subdomain A-TITLE Rabobank Waterland en Omstreken
https://www.tmalogistics.nl/?u...New window External Subdomain A-TITLE TMA Logistics
http://www.vab-volendam.nl/?ut...New window External Subdomain A-TITLE VAB Afbouwgroep
https://www.vanmossel.nl/?utm_...New window External Subdomain A-TITLE Van Mossel
https://vdh-solar.nl/?utm_sour...New window External A-TITLE Navetto
https://vdkgroep.com/?utm_sour...New window External A-TITLE VDK Groep
https://www.volare-kinderfiets...New window External Subdomain A-TITLE Volare Kinderfietsen
https://fcvolendam.nl/Anchor No Text
https://shop.fcvolendam.nl/External Subdomain No Text
https://fcvolendam.nl/No Text
/voetbal/nieuws/Text duplicate Nieuws
A-TITLE Nieuws
/voetbal/1e-elftal/Text duplicate 1e Elftal
A-TITLE 1e Elftal
/voetbal/jong-volendam/Text duplicate Jong FC Volendam
A-TITLE Jong FC Volendam
/voetbal/fc-volendam-o19/Text duplicate FC Volendam O19
A-TITLE FC Volendam O19
/voetbal/jeugdacademie/Text duplicate Jeugdacademie
A-TITLE Jeugdacademie
/voetbal/agenda/Text duplicate Agenda & uitslagen
A-TITLE Agenda & uitslagen
/club/supporterszaken/Text duplicate Supporterszaken
A-TITLE Supporterszaken
/club/perszaken/Text duplicate Mediabeleid
A-TITLE Mediabeleid
/club/organisatie/Text duplicate Organisatie
A-TITLE Organisatie
/club/vacatures/Text duplicate Vacatures en stages
A-TITLE Vacatures en stages
/club/veilig-sportklimaat/Text duplicate Veilig sportklimaat
A-TITLE Veilig sportklimaat
/zakelijk/nieuws/Text duplicate Nieuws
A-TITLE Nieuws
/zakelijk/vergaderruimtes/Text duplicate Vergaderruimtes
A-TITLE Vergaderruimtes
/zakelijk/dineren/Text duplicate Dineren
A-TITLE Dineren
/zakelijk/onze-sponsoren/Text duplicate Onze sponsoren
A-TITLE Onze sponsoren
/zakelijk/businessclub-het-and...Text duplicate Businessclub 'Het Andere Oranje'
A-TITLE Businessclub 'Het Andere Oranje'
/zakelijk/club-van-200/Text duplicate Club van 200
A-TITLE Club van 200
/zakelijk/overige-sponsormogel...Text duplicate Overige Sponsormogelijkheden
A-TITLE Overige Sponsormogelijkheden
/zakelijk/skyboxen/Text duplicate Skyboxen
A-TITLE Skyboxen
/zakelijk/fc-volendam-stadiont...Text duplicate Stadiontour FC Volendam
A-TITLE Stadiontour FC Volendam
/kras-stadion/algemene-informa...Text duplicate Algemene Informatie
A-TITLE Algemene Informatie
/kras-stadion/bereikbaarheid/Text duplicate Bereikbaarheid & Parkeren
A-TITLE Bereikbaarheid & Parkeren
/kras-stadion/fanshop/Text duplicate Fanshop
A-TITLE Fanshop
/kras-stadion/huisregels-fc-vo...Text duplicate Huisregels FC Volendam
A-TITLE Huisregels FC Volendam
/kras-stadion/fc-volendam-stad...Text duplicate FC Volendam Stadiontour
A-TITLE FC Volendam Stadiontour
https://fcvolendam.nl/webshop/Text duplicate Webshop
A-TITLE Webshop
https://fcvolendam.nl/tickets/Text duplicate Ticketverkoop
A-TITLE Ticketverkoop
https://fcvolendam.nl/tv/Text duplicate FC Volendam TV
A-TITLE FC Volendam TV
https://fcvolendam.nl/contact/Text duplicate Contact
A-TITLE Contact
https://fcvolendam.nl/app/App
A-TITLE App
https://www.number1-voetbalrei...New window External Subdomain number1-voetbalreizen.nl
IMG-ALT number1-voetbalreizen.nl
A-TITLE number1-voetbalreizen.nl
https://www.voetbalticketshop.nl/New window External Subdomain voetbalticketshop.nl
IMG-ALT voetbalticketshop.nl
A-TITLE voetbalticketshop.nl
http://voetbalreizenxl.nl/New window External voetbalreizenxl.nl
IMG-ALT voetbalreizenxl.nl
A-TITLE voetbalreizenxl.nl
https://premium-sportstravel.nl/New window External premium-sportstravel.nl/
IMG-ALT premium-sportstravel.nl/
A-TITLE premium-sportstravel.nl/
https://www.uitvaartverzekerin...New window External Subdomain uitvaartverzekeringvergelijken.com
IMG-ALT uitvaartverzekeringvergelijken.com
A-TITLE uitvaartverzekeringvergelijken.com
http://photobooth.com/New window External photobooth.com
IMG-ALT photobooth.com
A-TITLE photobooth.com
https://www.onderneming.nl/New window External Subdomain Onderneming.nl
IMG-ALT Onderneming.nl
A-TITLE Onderneming.nl
https://bankrekening.nl/New window External Bankrekening.nl
IMG-ALT Bankrekening.nl
A-TITLE Bankrekening.nl
https://zakelijkgeld.nl/New window External Zakelijkgeld.nl
IMG-ALT Zakelijkgeld.nl
A-TITLE Zakelijkgeld.nl
https://www.transfermarkt.nl/w...New window External Subdomain transfermarkt.nl/wedden/
IMG-ALT transfermarkt.nl/wedden/
A-TITLE transfermarkt.nl/wedden/
https://www.weddenbonus.com/New window External Subdomain weddenbonus.com
IMG-ALT weddenbonus.com
A-TITLE weddenbonus.com
https://www.ofsgroep.nl/New window External Subdomain OFSgroep
IMG-ALT OFSgroep
A-TITLE OFSgroep
https://kredietwinkel.nl/New window External Kredietwinkel.nl
A-TITLE Kredietwinkel.nl
https://creditcardvergelijken.nl/New window External Creditcardvergelijken.nl
A-TITLE Creditcardvergelijken.nl
/overig/privacy-verklaring/Privacyverklaring
/cookie-statement/Cookie Statement
https://www.studioweb.nl/?utm_...New window External Subdomain Studioweb.nl
A-TITLE Studioweb realiseert websites, applicaties en alles op het gebied van internet

Server configuration

HTTP redirects
(Critically important)
This page redirects to "https://fcvolendam.nl/"
HTTP header
(Important)
The X-powered header is sent within the response header. (unnecessary)
The web server transmits the web page (HTML) in compressed form.
Performance
(Somewhat important)
The page response time of 0.41 seconds is longer than the recommended limit of 0.4 seconds. A high response time unnecessarily slows down search engine crawling and results in bad user experience as well.
The file size of the HTML document is fine (41 kB).

HTTP Response Header

NameValue
dateWed, 23 Jul 2025 01:57:44 GMT
content-typetext/html; charset=utf-8
servercloudflare
varyAccept-Encoding
nel{"report_to":"cf-nel","success_fraction":0.0,"max_age":604800}
expiresThu, 19 Nov 1981 08:52:00 GMT
cache-controlno-store, no-cache, must-revalidate, post-check=0, pre-check=0
pragmano-cache
x-powered-byProcessWire CMS
x-xss-protection1; mode=block
report-to{"group":"cf-nel","max_age":604800,"endpoints":[{"url":"https://a.nel.cloudflare.com/report/v4?s=R0peMTy6jU23wYuGkBW%2FAT07Ez9u2ltHqGuHFT2Wwy6xlL%2B8u18pnKd%2Fm8EYH88klMdUvdQWE0sQ1Jc9xYd83DSdQPsDyqgBATgxuxo%3D"}]}
cf-cache-statusDYNAMIC
content-encodingzstd
set-cookie58 Characters
cf-ray963791980bfd9eea-CDG
alt-svch3=":443"; ma=86400
statuscode200
http_versionHTTP/2

External factors

This page is referenced by wikipedia.
This website has excellent links from other websites.
This page has backlinks from 227 referring domains.
This page has 13,338 backlinks.
This page has backlinks from 203 different ip addresses.

Search preview

fcvolendam.nl
FC Volendam
TEKTS TICKET BUTTON WAS: TICKETS LINK WAS: https://tickets.fcvolendam.nl/dashboard Scoor nu je tickets! Scoor nu je seizoenkaart!..

Most important keywords

Following keywords were found. You can check the keyword optimization of this page for each keyword.

KeywordResultRecheck
FC Volendam86%Check
Volendam77%Check
FC Volendam TV72%Check
RKAV Volendam56%Check
FCVD52%Check
TICKETS50%Check
Actueel50%Check
SCOOR46%Check
Seizoenkaart46%Check
Scoor nu44%Check

Automatically check fcvolendam.nl including all subpages at once!

Try for free
Guaranteed free of charge during trial period.

Cookie Policy

We use cookies to make our site work and also for analytics and advertising purposes. You can enable or disable optional cookies as desired. See the following links for more information.

We need these so the site can function properly

So we can better understand how visitors use our website

So we can serve you tailored ads and promotions